powered by:
Protein Alignment CG11977 and CRISPLD1
DIOPT Version :9
Sequence 1: | NP_649855.3 |
Gene: | CG11977 / 41076 |
FlyBaseID: | FBgn0037650 |
Length: | 274 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_113649.1 |
Gene: | CRISPLD1 / 83690 |
HGNCID: | 18206 |
Length: | 500 |
Species: | Homo sapiens |
Alignment Length: | 69 |
Identity: | 16/69 - (23%) |
Similarity: | 28/69 - (40%) |
Gaps: | 10/69 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 62 KFWSTKCGRNHEGVR-MSDYRYDIVRNVNNFRRKLEWGLGNLPRAVKFKNIKWDDELSVMAMRVS 125
::|..| ..|.| ::|.....:.:::|..|...: |.|...:.:.||.||...|...:
Human 45 EWWIAK----QRGKRAITDNDMQSILDLHNKLRSQVY-----PTASNMEYMTWDVELERSAESWA 100
Fly 126 NQCL 129
..||
Human 101 ESCL 104
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1528782at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.