DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11977 and AT5G66590

DIOPT Version :9

Sequence 1:	NP_649855.3	Gene:	CG11977 / 41076	FlyBaseID:	FBgn0037650	Length:	274	Species:	Drosophila melanogaster
Sequence 2:	NP_201460.1	Gene:	AT5G66590 / 836791	AraportID:	AT5G66590	Length:	185	Species:	Arabidopsis thaliana

Alignment Length:	62	Identity:	17/62 - (27%)
Similarity:	21/62 - (33%)	Gaps:	24/62 - (38%)

- Green bases have known domain annotations that are detailed below.

  Fly     2 NLLWA---IVIVAELKCHTGHTVFRTRWPTYVQKKHYNIPVKPPDYCNADICPANKKHITCG 60
            |.|||   :.:...|...|        |  ..:|..||.        .:|.|.||.   |||
plant   101 NQLWAKGLVAVTPSLAVET--------W--VKEKPFYNY--------KSDTCAANH---TCG 141

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11977	NP_649855.3	SCP_euk	81..226	CDD:240180
AT5G66590	NP_201460.1	CAP_PR-1	46..185	CDD:349400	17/62 (27%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1528782at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.010