DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11977 and AT5G26130

DIOPT Version :9

Sequence 1:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_197985.2 Gene:AT5G26130 / 832682 AraportID:AT5G26130 Length:166 Species:Arabidopsis thaliana


Alignment Length:208 Identity:36/208 - (17%)
Similarity:53/208 - (25%) Gaps:95/208 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 YNIPVK----PPDYCNADICPANKKHITCGF--KFWSTKCGRNHEGVRMSDYRYDIVR------- 86
            :.:|:|    |.||.:..    |:.....|.  ..|       |.|.....:.|...|       
plant    21 FAVPLKAQDQPQDYLDEH----NRARTQVGVPPMKW-------HAGAEQYAWNYAQQRKGDCSLT 74

  Fly    87 --NVNN-FRRKLEWGLGNL--PRAVKFKNIKWDDELSVMAMRVSNQCLQHTFSPCVNTFLYKDVG 146
              |.|. :...|.|..|.|  ..|||.    |                               |.
plant    75 HSNSNGLYGENLAWSGGALSGAEAVKL----W-------------------------------VN 104

  Fly   147 ESSDFVKVQNTSKGFNVISFLNMWFEYHKMMKPSYVNNFPNIAPQDRLIIFANLIYEKNKKMGCG 211
            |.||::...||.........                              :..:::..::.:||.
plant   105 EKSDYIYASNTCSDGKQCGH------------------------------YTQVVWRTSEWVGCA 139

  Fly   212 MVK-SGQGRFLTC 223
            .|| ...|.|:||
plant   140 KVKCDNGGTFVTC 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11977NP_649855.3 SCP_euk 81..226 CDD:240180 26/156 (17%)
AT5G26130NP_197985.2 CAP_PR-1 31..166 CDD:349400 34/198 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.