DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11977 and AT5G02730

DIOPT Version :9

Sequence 1:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_195893.1 Gene:AT5G02730 / 831820 AraportID:AT5G02730 Length:205 Species:Arabidopsis thaliana


Alignment Length:110 Identity:30/110 - (27%)
Similarity:43/110 - (39%) Gaps:24/110 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 GVRMSDYRYDIVRNVNNFRR---KLEWGLG-NLPR-AVKFKNIKWDDELSVMAMRVSNQ----C- 128
            |....|.:....|..|..||   ..|:.|. |..| |....|::||..|:..|.:.:.|    | 
plant    34 GTSSPDTKAAAARATNRGRRNKQSAEFLLAHNAARVASGASNLRWDQGLARFASKWAKQRKSDCK 98

  Fly   129 LQHTFSPC-VNTFLY-------------KDVGESSDFVKVQNTSK 159
            :.|:..|. .|.|.|             |.:.||.::.:|.||.|
plant    99 MTHSGGPYGENIFRYQRSENWSPRRVVDKWMDESLNYDRVANTCK 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11977NP_649855.3 SCP_euk 81..226 CDD:240180 28/103 (27%)
AT5G02730NP_195893.1 SCP_PR-1_like 57..193 CDD:240181 24/87 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.