DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11977 and AT2G19980

DIOPT Version :9

Sequence 1:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_179588.1 Gene:AT2G19980 / 816517 AraportID:AT2G19980 Length:165 Species:Arabidopsis thaliana


Alignment Length:148 Identity:30/148 - (20%)
Similarity:56/148 - (37%) Gaps:32/148 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 RMSDYRYDIVRNVNNFRRKLEWGLGNLPRAVKFKNIKWDDELSVMAMRVSNQCLQHTFSPCVNTF 140
            ||.|.:......|:|..|..:..|.  ..|.::.|::..|    .||:.|..          .|:
plant    29 RMDDLQPAETLAVHNQIRAADQKLA--AHAQRYANVRSQD----CAMKYSTD----------GTY 77

  Fly   141 LYKDVGE--SSDFVKVQNTSKGFNVISFLNMWFEYHKMMKPSYVNNFPNIAPQDRLIIFANLIYE 203
                 ||  ::.:|:..:|..|.....|   ||    ..||.|  |:......:....:..::..
plant    78 -----GENIAAGWVQPMDTMSGPIATKF---WF----TEKPYY--NYATNKCSEPCGHYTQIVAN 128

  Fly   204 KNKKMGCGMVKSGQGRFL 221
            ::..:|||.|:..:..::
plant   129 QSTHLGCGTVRCFKNEYV 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11977NP_649855.3 SCP_euk 81..226 CDD:240180 27/143 (19%)
AT2G19980NP_179588.1 SCP 35..165 CDD:294090 27/142 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.