DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11977 and PRB1

DIOPT Version :9

Sequence 1:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_179064.1 Gene:PRB1 / 815945 AraportID:AT2G14580 Length:161 Species:Arabidopsis thaliana


Alignment Length:175 Identity:37/175 - (21%)
Similarity:68/175 - (38%) Gaps:50/175 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 VRMSDYRYDIVRNVNNFRRKLEWGLGNLPRAVKFKNIKWDDELSVMAMRVSNQ----C-LQHTFS 134
            ::..|.:.|.|...|..|.::  |:|.:         :||:.|:..|...:||    | |.|:..
plant    24 LKAQDSQQDYVNAHNQARSQI--GVGPM---------QWDEGLAAYARNYANQLKGDCRLVHSRG 77

  Fly   135 PCVNTFLYKDVGESSDFVKVQNTSKGFNVISFLNMWFEYHKMMKPSY---VNNFPNIAPQDRLII 196
            | ....|.|..|:.|.             ::.:|:|..    .|.:|   .|....:...     
plant    78 P-YGENLAKSGGDLSG-------------VAAVNLWVN----EKANYNYDTNTCNGVCGH----- 119

  Fly   197 FANLIYEKNKKMGCGMVK-SGQGRFLTCLFDKKIKP----NQKLY 236
            :..:::..:.::||..|: :..|..::|.:|   .|    |||.|
plant   120 YTQVVWRNSVRLGCAKVRCNNGGTIISCNYD---PPGNYANQKPY 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11977NP_649855.3 SCP_euk 81..226 CDD:240180 30/153 (20%)
PRB1NP_179064.1 CAP_PR-1 30..161 CDD:349400 35/167 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.