DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11977 and Crispld2

DIOPT Version :9

Sequence 1:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001297564.1 Gene:Crispld2 / 78892 MGIID:1926142 Length:495 Species:Mus musculus


Alignment Length:154 Identity:37/154 - (24%)
Similarity:66/154 - (42%) Gaps:33/154 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 HEGVR----MSDYRYDIVRNVNNFRRKLEWGLGNLPRAVKFKNIKWDDELSVMAMRVSNQCL-QH 131
            |..||    ||| |.:|:...|..|.::      .|.|...:::.||:||...|...:::|| :|
Mouse    44 HSRVRRAIPMSD-RQEILMLHNKLRGQV------YPPASNMEHMTWDEELERSAAAWAHRCLWEH 101

  Fly   132 TFSPCVNTFLYKDVGESSDFVKVQNTSKGFNVISFLNMWFEYHKMMKPSYVNNFPN-IAPQDR-- 193
              .|   ..|.:.:|::......:..|.||:|.|    |::..|    .|...:|: ..|:.|  
Mouse   102 --GP---AGLLRSIGQNLAVHWGRYRSPGFHVQS----WYDEVK----DYTYPYPHECTPRCRER 153

  Fly   194 -----LIIFANLIYEKNKKMGCGM 212
                 ...:..:::....|:||.:
Mouse   154 CSGPMCTHYTQMVWATTNKIGCAV 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11977NP_649855.3 SCP_euk 81..226 CDD:240180 31/141 (22%)
Crispld2NP_001297564.1 CAP 56..201 CDD:381818 31/141 (22%)
LCCL 284..368 CDD:128866
LCCL 387..486 CDD:367672
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.