DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11977 and Crisp4

DIOPT Version :9

Sequence 1:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001333976.1 Gene:Crisp4 / 78081 MGIID:1925331 Length:293 Species:Mus musculus


Alignment Length:153 Identity:27/153 - (17%)
Similarity:51/153 - (33%) Gaps:34/153 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 DIVRNVNNFRRKLEWGLGNLPRAVKFKNIKWDDELSVMAMRVSNQCLQHTFSPCVNTFLYKDVGE 147
            :||...|.||||:.      |.|.....:.|....:..|..::..|               |..:
Mouse    87 EIVNTHNAFRRKVS------PPARNMLKVSWSSAAAENARILARYC---------------DKSD 130

  Fly   148 SSDFV-KVQNTSKGFNVI---------SFLNMWFEYHKMMKPSYVNNFPNIAPQDRLIIFANLIY 202
            |.... ::.||..|.|::         ..:.:||...|..|   ...:|:.........:..:::
Mouse   131 SDSLERRLPNTFCGENMLMEHYPSSWSKVIEIWFNESKYFK---YGEWPSTDDDIETDHYTQMVW 192

  Fly   203 EKNKKMGCGMVKSGQGRFLTCLF 225
            .....:||.:....:.:..|.|:
Mouse   193 ASTYLVGCDVAACRRQKAATYLY 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11977NP_649855.3 SCP_euk 81..226 CDD:240180 27/153 (18%)
Crisp4NP_001333976.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.