DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11977 and Glipr2

DIOPT Version :9

Sequence 1:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster
Sequence 2:XP_006238202.1 Gene:Glipr2 / 679819 RGDID:1583669 Length:170 Species:Rattus norvegicus


Alignment Length:177 Identity:28/177 - (15%)
Similarity:62/177 - (35%) Gaps:53/177 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 YRYDIVRNVNNFRRKLEWGLGNLPRAVKFKNIKWDDELSVMAMRVSNQCLQHTFSP------CVN 138
            :..::::..|.:|.|     ..:|.....|.:..:.:....|: .|.:.|:|  ||      |  
  Rat    25 FNNEVLKAHNEYRAK-----HGVPPLKLCKKLNQEAQQYSEAL-ASTRILKH--SPESSRGQC-- 79

  Fly   139 TFLYKDVGESSDFVKVQNTSKGFNVISFLNMWF---EYHKMMKPSYVNNFPNIAPQDRLIIFANL 200
                   ||:..:.....|.|     ...:.|:   :.:...:|.:.:...:         |..:
  Rat    80 -------GENLAWASYDQTGK-----EVADRWYSEIKSYNFQQPGFTSGTGH---------FTAM 123

  Fly   201 IYEKNKKMGCGMVKSGQG------RFLTC-------LFDKKIKPNQK 234
            :::..||:|.|...:..|      |:...       .|::.:.|.:|
  Rat   124 VWKNTKKIGVGKASASDGSSFVVARYFPAGNIVNQGFFEENVPPPKK 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11977NP_649855.3 SCP_euk 81..226 CDD:240180 25/166 (15%)
Glipr2XP_006238202.1 SCP_GAPR-1_like 24..155 CDD:240182 25/160 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.