DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11977 and crispld2

DIOPT Version :9

Sequence 1:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001027499.1 Gene:crispld2 / 613091 XenbaseID:XB-GENE-985953 Length:500 Species:Xenopus tropicalis


Alignment Length:235 Identity:57/235 - (24%)
Similarity:85/235 - (36%) Gaps:73/235 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 CNADICP---ANKKHITCGFKFW---STKC-GRNHEGV-RMSDYRYDIVRN------VNNFRRKL 95
            ||...||   .|.|....|..|:   |:.| ...|.|| ..|....||.|.      |.:.|..:
 Frog   306 CNRYKCPPGCINSKAKVFGTLFYDSMSSICRAAIHYGVIDNSGGLVDITRKGRLQFFVKSTRNSV 370

  Fly    96 EWGLGNLPRAVKFKNIKWDDELSVMAMRVSNQCLQHTFSPCVNTFLYKDVGESSDFVKVQNTSKG 160
            |       ...|||...     |.|..:||.|.:.     |     |..|.|...|||.......
 Frog   371 E-------SISKFKPAN-----SFMVSKVSAQTID-----C-----YTTVAEICQFVKPATHCPR 413

  Fly   161 FNVISFLNMWFEYHKMMKPSYVNNFPNI-APQDRLIIFANLIYEKNK----KMGCGMVKSGQGRF 220
            ||.               |::..|.|:. ||    :|..|:..:.:.    .:..|::|.|:|.:
 Frog   414 FNC---------------PAHCKNEPSYWAP----VIGTNIYADSSSICKTAVHAGVIKDGEGGY 459

  Fly   221 LTCL-FDKKIKPNQKLYTTRLNDPFRTNRKTNETESIQSN 259
            :..: .:||     |.|       |.:|:...:::|||::
 Frog   460 VDVMPVEKK-----KHY-------FGSNKNGIQSDSIQNH 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11977NP_649855.3 SCP_euk 81..226 CDD:240180 34/156 (22%)
crispld2NP_001027499.1 SCP_euk 57..202 CDD:240180
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..281
LCCL 289..373 CDD:128866 20/73 (27%)
LCCL 392..490 CDD:281766 29/137 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.