DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11977 and crispl

DIOPT Version :9

Sequence 1:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001025526.1 Gene:crispl / 594930 XenbaseID:XB-GENE-5768874 Length:314 Species:Xenopus tropicalis


Alignment Length:286 Identity:60/286 - (20%)
Similarity:93/286 - (32%) Gaps:105/286 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 TGHTVFRTRWPTYVQKKHYN----IPVKPP--DYCN-------------------ADICPAN-KK 55
            |.|.:.|.:..|:.|..:..    ||...|  ||.|                   ..|.|.| :|
 Frog    27 TNHPLARHQVSTFPQNPNKREIAWIPTAAPFSDYGNDTTQHPAGGSRRKRAGGRKITIPPENIEK 91

  Fly    56 HITCGFKFWSTKCGRNHEGVRMSDYRYDIVRNVNN-FRRKLEWGLGNLPRAVKFKNIKWDDELSV 119
            .....|...||....|.:.          :.||:| .||.     .|.|.:...|.: |.|..:.
 Frog    92 MKNVPFSALSTDLESNRQS----------ILNVHNELRRN-----ANPPPSNMLKMV-WSDLAAK 140

  Fly   120 MAMRVSNQCLQ-HTFSP--------C-VNTFL------YKDV-----GESSDFVKVQNTSK-GFN 162
            .|.:.:|.|.| |:..|        | .|.|:      ::||     .|..||:..:...: |..
 Frog   141 SAAKWANSCKQYHSLKPERTIPGFSCGENLFMASYKASWEDVIRAFYSEIEDFLYGKGAKEVGLQ 205

  Fly   163 VISFLN-MWF-------------------EYHKMMKPSYVNNFPNIAPQDRLIIFANLIYEKNK- 206
            ::.|.. |||                   |::.:...:...|:.|:          .:.|:..| 
 Frog   206 ILHFTQVMWFSSWLVGCAAAQCPITDHSLEFYFVCHYAPAGNYGNV----------GIPYKTGKP 260

  Fly   207 ----KMGC--GMVKSG---QGRFLTC 223
                |..|  |:..:|   |.:|..|
 Frog   261 CEDCKSSCENGLCTNGCNFQNKFSNC 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11977NP_649855.3 SCP_euk 81..226 CDD:240180 41/196 (21%)
crisplNP_001025526.1 CAP_CRISP 106..245 CDD:349402 31/154 (20%)
Crisp 261..314 CDD:369954 7/26 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.