DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11977 and pi15b

DIOPT Version :9

Sequence 1:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster
Sequence 2:XP_684600.2 Gene:pi15b / 556658 ZFINID:ZDB-GENE-070912-590 Length:257 Species:Danio rerio


Alignment Length:179 Identity:35/179 - (19%)
Similarity:63/179 - (35%) Gaps:57/179 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 VRMSDYRYDIVRNVNNFRRKLEWGLGNLPRAVKFKNIKWDDELSVMAMRVSNQCLQHTFSPCVNT 139
            :.:.||...:..||             .|.|...:.:.|||.|:..|...:..|:.....|    
Zfish    67 IAILDYHNKVRANV-------------FPPAANMEYMLWDDGLARSAEAWAATCIWEHGPP---- 114

  Fly   140 FLYKDVGESSDFVKVQNTS-KGFNVISFLNMWFEYHKMMKPSY--VNNFPNIAPQD--------- 192
            :|.:.:|        ||.| :..|..|.|       :::||.|  |.::....|:|         
Zfish   115 YLLRYLG--------QNLSVRTGNYRSIL-------QLVKPWYDEVRDYMFPYPRDCNPHCPMRC 164

  Fly   193 ---RLIIFANLIYEKNKKMGC------GMVKSG----QGRFLTCLFDKK 228
               ....:..:::..:.::||      .||..|    :..:|.|.:..|
Zfish   165 YGPMCTHYTQMVWASSNRVGCAIQTCFNMVVWGAVWREATYLVCNYSPK 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11977NP_649855.3 SCP_euk 81..226 CDD:240180 32/169 (19%)
pi15bXP_684600.2 SCP_euk 68..211 CDD:240180 34/174 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.