DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11977 and PI15

DIOPT Version :9

Sequence 1:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001311332.1 Gene:PI15 / 51050 HGNCID:8946 Length:258 Species:Homo sapiens


Alignment Length:180 Identity:32/180 - (17%)
Similarity:66/180 - (36%) Gaps:54/180 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 NADICPANKKHITCGFKFWSTKCGRNHEGVRMSDYRYDIVRNVNNFRRKLEWGLGNLPRAVKFKN 110
            :|||..|.:|...           ..::.:.:.||.       |..|.|:      .|.|...:.
Human    50 SADIPKARRKRYI-----------SQNDMIAILDYH-------NQVRGKV------FPPAANMEY 90

  Fly   111 IKWDDELSVMAMRVSNQCL-QHTFSPCVNTFLYKDVGESSDFVKVQNTSKGFNVISFLNMWFEYH 174
            :.||:.|:..|...:..|: .|  .|   ::|.:.:|::...    .|.:..:::..:..|::..
Human    91 MVWDENLAKSAEAWAATCIWDH--GP---SYLLRFLGQNLSV----RTGRYRSILQLVKPWYDEV 146

  Fly   175 KMMKPSYVNNFPNIAPQD------------RLIIFANLIYEKNKKMGCGM 212
            |    .|.  ||  .|||            ....:..:::..:.::||.:
Human   147 K----DYA--FP--YPQDCNPRCPMRCFGPMCTHYTQMVWATSNRIGCAI 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11977NP_649855.3 SCP_euk 81..226 CDD:240180 25/145 (17%)
PI15NP_001311332.1 CAP_PI15 67..212 CDD:349408 27/152 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.