DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11977 and crisp1.3

DIOPT Version :9

Sequence 1:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001008204.1 Gene:crisp1.3 / 493566 XenbaseID:XB-GENE-951048 Length:240 Species:Xenopus tropicalis


Alignment Length:193 Identity:39/193 - (20%)
Similarity:71/193 - (36%) Gaps:43/193 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 IVRNVNNFRRKLEWGLGNLPRAVKFKNIKWDDELSVMAMRVSNQCLQHTFSPCVNTFLYKDVGES 148
            |:...||:||...      |.|.....:.|:.:.::.|...:..| ..:.||             
 Frog    38 IINAHNNYRRNAS------PSARNMLKMVWNKDAAINAASWAATC-SESHSP------------- 82

  Fly   149 SDFVKVQNTSKGFN------VISFLNMWFEYHKMMKPSYVNNFP-NIAPQDRLII---FANLIYE 203
            ||    :.|..||.      :.|:...|.|..|.....| |:|. .:.|:...::   :..:::.
 Frog    83 SD----KRTIPGFGCGENLYMASYPASWEEAVKGWYSEY-NDFQYGVGPKSPGLVTGHYTQVMWY 142

  Fly   204 KNKKMGCGM---VKSGQGRFLTCLFDKKIKPNQKLYTTRLNDPFRTNRKTNETESIQSNSSST 263
            .:..:||.:   .||....|..|.:    .|...|.:| ::.|::|..|..:..:...|...|
 Frog   143 NSYMVGCSVSYCPKSPYKYFYVCQY----CPAGNLDST-MSTPYKTGPKCADCPTACDNGLCT 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11977NP_649855.3 SCP_euk 81..226 CDD:240180 31/154 (20%)
crisp1.3NP_001008204.1 CAP_CRISP 33..170 CDD:349402 31/160 (19%)
Crisp 187..240 CDD:369954 2/14 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.