DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11977 and Ag5r2

DIOPT Version :9

Sequence 1:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster


Alignment Length:184 Identity:49/184 - (26%)
Similarity:83/184 - (45%) Gaps:20/184 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 DYCNADICPANKKHITCGF-KFWSTKCGRNHEGVRMS-DYRYDIVRNVNNFRRKLEWGL-GNLPR 104
            |||::|||... .||.||. .:|.:.|..:.|.:.:: ||::..|.:.|:.|..:..|. .|...
  Fly    20 DYCSSDICNGG-SHIACGHSNWWDSSCPGDAELIDINDDYKWVFVHSHNDKRNYIAGGYDSNHNA 83

  Fly   105 AVKFKNIKWDDELSVMAMRVSNQC-LQHTFSPCVNTFLYKDVGE-------SSDFVKVQNTSKGF 161
            |.:...::|||||:.:|.....|| :.|  ..|.||..:|..|:       |.|.     ...|:
  Fly    84 ACRMATMEWDDELAYLASLNVRQCNMVH--DSCHNTDAFKYSGQNLAWQAYSGDL-----PDMGY 141

  Fly   162 NVISFLNMWF-EYHKMMKPSYVNNFPNIAPQDRLIIFANLIYEKNKKMGCGMVK 214
            .:.:.:.||| |.|..........:|:......:..|..::.|:|.::||...:
  Fly   142 ILDNSVQMWFDEVHNSNAGIIAGGYPSGYNGPAIGHFTVMMSERNTRLGCAAAR 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11977NP_649855.3 SCP_euk 81..226 CDD:240180 34/144 (24%)
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 34/141 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.