DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11977 and scpr-C

DIOPT Version :9

Sequence 1:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001287282.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster


Alignment Length:205 Identity:49/205 - (23%)
Similarity:83/205 - (40%) Gaps:13/205 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 DYCNADICPANKKHITCGFK-FWSTKCGRNHEGVRMSDYRYDIVRNVNNFRRKLEWG-LGNLPRA 105
            |||....|  ..|||.|..| .:|..|.::...|::..:...|:...|..|..:..| :..||:|
  Fly    20 DYCALPTC--LDKHIACNNKGNFSENCPKDVREVKIEPHHKLILNLFNELRNNVAGGKIEGLPKA 82

  Fly   106 VKFKNIKWDDELSVMAMRVSNQCLQHTFSPCVNTFLYKDVGESSDFVKVQNTSKGFN----VISF 166
            |:...:.|.:|||.:|:.....| :.....|.:|..:...|:::...:.......:.    :...
  Fly    83 VRMAKMSWCEELSHLALLNVKTC-ESLPDKCRSTERFAYAGQNNAVFQYSGAETEYTDAEIIKEQ 146

  Fly   167 LNMWFEYHKMMKPSYVNNFPNIAPQDRLIIFANLIYEKNKKMGCGMVKSGQGRF----LTCLFDK 227
            :..||.......|..:.:||...|...:..|...:.|||..:||..|:..:..:    |||.|..
  Fly   147 IENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGCAAVRFSRDFYNHFVLTCNFAT 211

  Fly   228 KIKPNQKLYT 237
            .....|.:||
  Fly   212 SNIVGQPVYT 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11977NP_649855.3 SCP_euk 81..226 CDD:240180 33/153 (22%)
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 33/152 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.