DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11977 and crisp1.7

DIOPT Version :9

Sequence 1:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_989314.1 Gene:crisp1.7 / 394939 XenbaseID:XB-GENE-5779195 Length:244 Species:Xenopus tropicalis


Alignment Length:191 Identity:36/191 - (18%)
Similarity:63/191 - (32%) Gaps:55/191 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 RMSDYRYDIVRNVNNFRRKLEWGLGNLPRAVKFKNIKWDDELSVMAMRVSNQCLQHTFSPCVNTF 140
            |.:..|..||...|.:||...      |.|.....:.|..|....|...:..|.|:...|...  
 Frog    29 RYATNRQKIVDIHNAYRRSAN------PTASNMLKMSWSIEAENNAKNWATTCNQYHSQPAAR-- 85

  Fly   141 LYKDVGESSDFVKVQNTSKGFNVI--SFLNMWFEYHKMMKPSYVN-NFPNIAPQDRLII--FANL 200
                        ::.|.:.|.|:.  |:...|.|..:.:...|.| .:...|....|:|  :..:
 Frog    86 ------------QIANITCGENLFMSSYPASWEEVIQSLHSEYDNFEYGVGAKAVGLVIGHYTQV 138

  Fly   201 IYEKNKKMGCGMVKSGQGRFLTCLFDKKIKPNQKL---------------YTTRLNDPFRT 246
            ::.|:.::||...:        |       ||..:               |..|:|.|:::
 Frog   139 MWYKSYRIGCYCTE--------C-------PNDGVRLKYYYVCQYYPAGNYADRINYPYKS 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11977NP_649855.3 SCP_euk 81..226 CDD:240180 29/149 (19%)
crisp1.7NP_989314.1 CAP_CRISP 32..171 CDD:349402 31/173 (18%)
Crisp 188..243 CDD:369954
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.