DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11977 and CG6628

DIOPT Version :9

Sequence 1:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster


Alignment Length:215 Identity:54/215 - (25%)
Similarity:90/215 - (41%) Gaps:16/215 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 NIPVKPPDYCNADICPANKKHITCGFK-FWSTKCGRNHEGVRMSDYRYDIVRNVNNFRRKLEWG- 98
            |....|.|||.:.:||:.||||.|..| ....:|..:...|.::..:..|:...|..|..|..| 
  Fly    23 NATAPPTDYCQSGLCPSLKKHIACKNKGELGKQCSPDAHLVNLTGLQDLILGEHNALRNVLASGK 87

  Fly    99 LGNLPRAVKFKNIKWDDELSVMAMRVSNQC-LQHTFSPCVNTFLYKDVGESSDFVKVQNTSKGFN 162
            :.|||:..:...::|..||:.:|.....|| |||  ..|.||..:.:.|::...|.:....:..|
  Fly    88 IINLPKPDRMATLQWHSELADLATLNVKQCVLQH--DSCHNTPDFHNSGQNLALVNITLLPEDGN 150

  Fly   163 ------VISFLNMWFEYHKMMKPSYVNNFPNIAPQDRLIIFANLIYEKNKKMGCGMVK----SGQ 217
                  |...:..|:.....:....:..||.....|.:..||.:..:.|..:||..::    :|.
  Fly   151 HTDECLVKESIGGWWNQSINITKEQLQRFPKGKLGDSIRNFAVMARDNNTHVGCAALRFEKPAGH 215

  Fly   218 GRF-LTCLFDKKIKPNQKLY 236
            ..| |.|.:.....|:..:|
  Fly   216 PLFLLACNYASNYVPDWPIY 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11977NP_649855.3 SCP_euk 81..226 CDD:240180 37/157 (24%)
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 37/157 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.