DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11977 and CG34049

DIOPT Version :9

Sequence 1:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster


Alignment Length:259 Identity:48/259 - (18%)
Similarity:90/259 - (34%) Gaps:80/259 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KCHTGHTVF-RTRWPTYVQKKHY---------------NIPVKPPDYCNADI------------- 49
            ||.:..|.| |.....|...::|               ::|||.|...|..:             
  Fly    37 KCRSCLTSFCRKPIKIYHNSRNYLACEVQRSQSINSIKSLPVKFPSTPNRSLNTEKDWSHGKRCL 101

  Fly    50 -CPANKKHITCGFKFWSTKCGRNHEG------------VRMSDYRYDIVRNVNNFRRKLEWGLGN 101
             |.|.|...:......|.|..::.:.            :|....:..::|..|.:||     |.|
  Fly   102 QCAAPKCKTSSRSSIQSKKLKKDKKSLLKEFEIYKIPIIRRKPIKQAVLRETNKYRR-----LHN 161

  Fly   102 LPRAVKFKNIKWDDELSVMAMRVSNQC-----LQHTFSPCVNTFLYKDVGESSDFVKVQNTSKGF 161
            .      ..:|.|::|...|...::..     |:...:|     ||   ||  :.::|:.:.  |
  Fly   162 A------NPLKMDEKLCSYAQEWADHLADLNKLETRPNP-----LY---GE--NIMRVRRSK--F 208

  Fly   162 NVISFLNMWFEYHKMMKPSYVNNFPNIAPQDRLII--FANLIYEKNKKMGCGMVKSGQGRFLTC 223
            :|...|.:|::      ..|  |:..:.|...|..  |..|::.:::.:|.|:.......::.|
  Fly   209 SVDQILKLWYQ------EKY--NYDYLKPGFNLYTGHFTQLVWRESEFLGVGVACDVSSIWIVC 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11977NP_649855.3 SCP_euk 81..226 CDD:240180 30/150 (20%)
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 30/150 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.