DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11977 and CG9822

DIOPT Version :10

Sequence 1:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster


Alignment Length:217 Identity:54/217 - (24%)
Similarity:93/217 - (42%) Gaps:36/217 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KPPDYCNADICPANKKHITCGFKFWSTKCGRNHEG-------VRMSDYRYDIVRNVNNFRRKLEW 97
            :|..:|:.|:||.|..||.|      ...|:.||.       |.:..||..||...|..|..:  
  Fly    22 QPLSWCDPDLCPDNTVHIAC------NNDGKFHESCSPDATMVDLKPYRKLIVNEHNKRRNYI-- 78

  Fly    98 GLGNLP---RAVKFKNIKWDDELSVMAMRVSNQC-LQHTFSPCVNTFLYKDVGESSDFVKVQNTS 158
            ..|:||   .|.:...:.||:||..:|......| |:|  ..|.|::.::::|::...|. :..:
  Fly    79 ASGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLEH--DDCHNSYRFRNLGQNLCGVD-RRRN 140

  Fly   159 KGFNVISF----LNMWFEYHKMMKPSYVNNFPNIAPQDRLIIFANLIYEKNKKMGCGMVKSGQGR 219
            ...||.:.    :.:||..||::..||:.:|......::...|...:.::|..:||.|::     
  Fly   141 WDLNVTNLVEQSMGLWFGEHKLIDSSYITDFKLTKDLEKYGHFVETVLDRNTHVGCAMMR----- 200

  Fly   220 FLTCLFDKKIKPNQKLYTTRLN 241
                 |.....|...:|.|..|
  Fly   201 -----FTNPQYPFLYIYNTACN 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11977NP_649855.3 CAP_euk 81..226 CDD:349399 35/152 (23%)
CG9822NP_611581.1 CAP_euk 64..219 CDD:349399 40/169 (24%)

Return to query results.
Submit another query.