DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11977 and Glipr1l2

DIOPT Version :9

Sequence 1:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster
Sequence 2:XP_002729829.4 Gene:Glipr1l2 / 366890 RGDID:1310205 Length:228 Species:Rattus norvegicus


Alignment Length:189 Identity:42/189 - (22%)
Similarity:72/189 - (38%) Gaps:34/189 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 DIVRNVNNFRRKLEWGLGNLPRAVKFKNIKWDDELSVMAMRVSNQCL---------QHTFSPCVN 138
            |.:....|...:|...:  .|..|..:.:.||..||..|.....:|:         .|...|   
  Rat    51 DFINEYVNLHNELRGTV--FPPGVNLRFMTWDVALSRTARAWGKKCVFERNTHLDKVHESHP--- 110

  Fly   139 TFLYKDVGESSDFVKVQNTSKGFNVISFLNMWFEYHKMMKPSYVNNFPNIAPQDRLIIFANLIYE 203
              ::.|:||:. :|   ...|.|...:.:..|.|..|..  :|||:  .....:....:..|:::
  Rat   111 --VFTDIGENM-WV---GPEKDFTATNAIRSWHEERKSY--NYVND--TCIEDEDCSHYIQLVWD 165

  Fly   204 KNKKMGCGMVKSGQGRFLT--CLFDKKIKPNQKLYTTRLNDPFRT----NRKTNETESI 256
            .:.|:||.:....:...:|  .||.....|...| |.|   |::.    :|.|||.:.|
  Rat   166 HSYKVGCAVTPCAKVGAITYAALFICNYAPGGTL-TRR---PYQAGQFCSRCTNEEKCI 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11977NP_649855.3 SCP_euk 81..226 CDD:240180 31/153 (20%)
Glipr1l2XP_002729829.4 CAP 51..197 CDD:412178 33/160 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.