DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11977 and CG17575

DIOPT Version :9

Sequence 1:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster


Alignment Length:305 Identity:63/305 - (20%)
Similarity:119/305 - (39%) Gaps:85/305 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 TRWPTYV--------QKKHYNIPVKPPDYCNADICPANKKHITC-GFKFWSTKCGRNHEGVRMSD 79
            |:||..:        |.:.:       |||:..:||..::||.| .|...:..|..:...||::.
  Fly     4 TKWPPLLLLLMLLGQQLQAF-------DYCDPTLCPGPERHIACNNFGALADICSPDAHIVRITT 61

  Fly    80 YRYDIVRN-VNNFRRKLEWG--LGNLPRAVKFKNIKWDDELSVMAMRVSNQCL---QHTFSPCVN 138
            .|..::.| :|.:|.::..|  :|..| |.:...::||.||:..|.....:|.   .|    |.|
  Fly    62 ARRTMILNELNEYRDRIARGDLMGFSP-ATRMATLQWDQELASFAELNVKRCALVNDH----CRN 121

  Fly   139 TFLYKDV-------GESSDFVKVQNTSKGFNVISFLNMWFEYH---KMMKPSYVNNFPN------ 187
            :..:::|       |...|.:...:.|...|..:.:.:  |||   :::|.:....|..      
  Fly   122 SEQFRNVAQVVAEGGWQGDPLPPSSPSDPPNPEAPIPV--EYHTEDEVIKATLEQMFAEYKECSM 184

  Fly   188 ---IA---PQDRLI---------IFANLIYEKNKKMGCGMVK--------SGQG-----RFLTCL 224
               ||   |.:|::         .|..|:.:....:|||:::        :||.     :::||.
  Fly   185 RDIIAFSPPNNRILRLRVSKCIAYFTQLVRDSTTHVGCGILRQTKNTTNEAGQSLSSVHQYMTCN 249

  Fly   225 FDKKIKPNQKLYTTRLNDPFRTNRKTNETESIQSNSSSTEAIVNL 269
            |            .|.||......::.:..:.:..|......:||
  Fly   250 F------------VRTNDVNAPVYQSGDRPATECRSGRNPVFINL 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11977NP_649855.3 SCP_euk 81..226 CDD:240180 40/194 (21%)
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 39/192 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.