DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11977 and Crisp2

DIOPT Version :9

Sequence 1:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001011710.1 Gene:Crisp2 / 360445 RGDID:621653 Length:243 Species:Rattus norvegicus


Alignment Length:147 Identity:28/147 - (19%)
Similarity:56/147 - (38%) Gaps:51/147 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 DIVRNVNNFRRKLEWGLGNLPRAVKFKNIKWDDELSVMAMRVSNQC-LQHTFSPCVNTFLYKDVG 146
            :|:...|..||::.      |.......::|:.:.:..|.:.:|.| |:|:              
  Rat    40 EIIAKHNELRRQVS------PPGSNILKMEWNVQAAANAQKWANNCILEHS-------------- 84

  Fly   147 ESSDFVKVQNTSKGFNVI---------SFLNMWFEYHKMMKPSYVNNF-------PNIAPQDRLI 195
             |::..|: |...|.|:.         :.:..|:|.::        ||       ||.|...   
  Rat    85 -STEDRKI-NIKCGENLYMSTDPTSWRTVIQSWYEENE--------NFVFGVGAKPNSAVGH--- 136

  Fly   196 IFANLIYEKNKKMGCGM 212
             :..|::..:.|:|||:
  Rat   137 -YTQLVWYSSFKVGCGV 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11977NP_649855.3 SCP_euk 81..226 CDD:240180 28/147 (19%)
Crisp2NP_001011710.1 CAP_CRISP 36..172 CDD:349402 28/147 (19%)
Crisp 189..243 CDD:400739
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.