DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11977 and CG32679

DIOPT Version :9

Sequence 1:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster


Alignment Length:252 Identity:58/252 - (23%)
Similarity:106/252 - (42%) Gaps:50/252 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 DYCNADICPANKKHITC--GFKFWSTKCGRNHEGVRMSDYRYDIVRNVNNFRRKL--EWGLGNLP 103
            :||:.::||:. :|:.|  ..:|.|   |.:.|.|:: |....::..::|.||.|  ..|:...|
  Fly    25 NYCDPELCPSG-RHVACQNSGRFVS---GCSGEFVQV-DAHIPLILQLHNERRNLIAGGGVSGFP 84

  Fly   104 RAVKFKNIKWDDELSVMAMRVSNQC-LQHTFSPCVNTFLYKDVGESSDFVKVQNTSKGFNVISFL 167
            .||:...:.||..|:.:|...:.|| :.|  ..|.||..|:..|::...:    .::..:|..||
  Fly    85 SAVQMATMSWDTTLAQLAAYNALQCRMAH--DECRNTNTYRYAGQNLSIL----FTRSVDVAVFL 143

  Fly   168 NM----WFEYHK-----MMKPSYVNNFPNIAPQDRLIIFANLIYEKNKKMGCGMVK-----SGQG 218
            ..    ||:.::     .|:...:...|.|..      |..::.|:|.::||.:.:     :.|.
  Fly   144 RQRIAAWFDENRDATSGDMEDYQMRGGPAIGH------FTTMVNERNNRVGCAIARFTDANNVQA 202

  Fly   219 RFLTCLFDKKIKPNQKLYTTRLNDP-FRTNRKTNE----TESIQSNSSSTEAIVNLN 270
            ..|.|.:         ..|..:|:| :|.....:|    ..|...|..|...:.|.|
  Fly   203 TLLACNY---------AVTNVVNNPVYRAGTAASECTTGRNSNYPNLCSPNEVYNYN 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11977NP_649855.3 SCP_euk 81..226 CDD:240180 36/161 (22%)
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 36/167 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.