DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11977 and Clec18a

DIOPT Version :9

Sequence 1:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster
Sequence 2:XP_038954171.1 Gene:Clec18a / 307851 RGDID:1559899 Length:497 Species:Rattus norvegicus


Alignment Length:139 Identity:24/139 - (17%)
Similarity:49/139 - (35%) Gaps:35/139 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 IVRNVNNFRRKLEWGLGNLPRAVKFKNIKWDDELSVMAMRVSNQC-----------LQHTFSPCV 137
            |:...|..|.::.      |.|...:.:.|.:.|:.:|...:..|           |::|     
  Rat    78 ILTTHNRLRSQVH------PSAANMQRMDWSESLAQLAQARAALCGTSATPNLAATLRNT----- 131

  Fly   138 NTFLYKDVGESSDFVKVQNTSKGFNVISFLNMWFEYHKMMKPSYVNNFPNIAPQDRLIIFANLIY 202
                 .|||.:...:.:.:.|    .:..:|:||....    .|.:.....|.......:..|::
  Rat   132 -----PDVGWNVQLLPMGSAS----FVEVVNVWFAEGL----QYRHGSAECAHNATCAHYTQLVW 183

  Fly   203 EKNKKMGCG 211
            ..:.::|||
  Rat   184 ATSSQLGCG 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11977NP_649855.3 SCP_euk 81..226 CDD:240180 24/139 (17%)
Clec18aXP_038954171.1 CAP_euk 77..211 CDD:349399 24/139 (17%)
CLECT 361..485 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.