DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11977 and Glipr1

DIOPT Version :9

Sequence 1:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001011987.1 Gene:Glipr1 / 299783 RGDID:1305978 Length:251 Species:Rattus norvegicus


Alignment Length:165 Identity:31/165 - (18%)
Similarity:69/165 - (41%) Gaps:20/165 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 GFKFWSTKCGRNHEGVRMSDYRYDIVRNVNNFRRKLEWGLGNLPRAVKFKNIKWDDELSVMAMRV 124
            ||.:.::...:    :...|:..:.|...|:||.|.      .|.|.....:.||.:|:.:|...
  Rat    17 GFSYTASTLPK----ITNEDFIEECVEVHNHFRSKA------YPPAGNMLYMSWDPKLAQIAKAW 71

  Fly   125 SNQCL-QHTFSPCVNTFLYKDVGESSDFVKVQNTSKGFNVISFLNMWFEYHKMMKPSYVNNFPNI 188
            :..|: ||  :|.:::.::.:.....:.:.:.:.|. |:|.:.:..|||      .|...:|...
  Rat    72 AQSCVFQH--NPQLHSRIHPNFTGLGENIWLGSLSL-FSVRAAILAWFE------ESQYYDFSTG 127

  Fly   189 APQDRLIIFANLIYEKNKKMGCGMVKSGQGRFLTC 223
            ..:.....:..:::..:.|:||.:....:|....|
  Rat   128 KCKKVCGHYTQIVWADSYKIGCAVQLCPRGANFIC 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11977NP_649855.3 SCP_euk 81..226 CDD:240180 28/144 (19%)
Glipr1NP_001011987.1 CAP 32..168 CDD:412178 29/146 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.