DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11977 and scl-9

DIOPT Version :9

Sequence 1:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_502497.1 Gene:scl-9 / 186048 WormBaseID:WBGene00009890 Length:213 Species:Caenorhabditis elegans


Alignment Length:143 Identity:38/143 - (26%)
Similarity:58/143 - (40%) Gaps:23/143 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 NVNN-FRRKLEWGLGNL-------PRAVKFKNIKWDDELSVMAMRVSNQCLQHTFSPCVNTFLYK 143
            ||:| ||.:|  .||.|       |.|...:.|.|..:|:..|.:.:..|.:: .|..:||    
 Worm    30 NVHNEFRSQL--ALGQLSFRGVKKPSASMMRKISWSKKLTNAATKFAETCPKN-HSVVMNT---- 87

  Fly   144 DVGESS--DFVKVQNTSKGFNVISFLNMWFEYHKMMKPSYVNNFPNIAPQDRLIIFA-NLIYEKN 205
              |||.  .|....:|.:.:..::....|.|:......|.:.|.   |.|...|..| .:.:...
 Worm    88 --GESIFWHFSSSLSTPEQYATLAPQKWWNEFETNGWDSLIYNH---ASQRFQIGHAVQMAWHTT 147

  Fly   206 KKMGCGMVKSGQG 218
            .|:|||..|...|
 Worm   148 SKVGCGYSKCAVG 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11977NP_649855.3 SCP_euk 81..226 CDD:240180 38/143 (27%)
scl-9NP_502497.1 SCP 23..174 CDD:214553 38/143 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.