powered by:
Protein Alignment CG11977 and scl-15
DIOPT Version :9
Sequence 1: | NP_649855.3 |
Gene: | CG11977 / 41076 |
FlyBaseID: | FBgn0037650 |
Length: | 274 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_494496.1 |
Gene: | scl-15 / 184099 |
WormBaseID: | WBGene00017183 |
Length: | 207 |
Species: | Caenorhabditis elegans |
Alignment Length: | 50 |
Identity: | 15/50 - (30%) |
Similarity: | 20/50 - (40%) |
Gaps: | 5/50 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 84 IVRNVNNFRRKLEWG--LGNLPRAVKFKNI---KWDDELSVMAMRVSNQC 128
||...|..|..:..| :.|..|.....|| |||..::..|...:|.|
Worm 27 IVDAHNTLRSSIAKGTYVANKTRKEPGSNILKMKWDPTIAKSAQAYANTC 76
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG11977 | NP_649855.3 |
SCP_euk |
81..226 |
CDD:240180 |
14/49 (29%) |
scl-15 | NP_494496.1 |
SCP |
22..173 |
CDD:214553 |
14/49 (29%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1528782at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.