Sequence 1: | NP_649855.3 | Gene: | CG11977 / 41076 | FlyBaseID: | FBgn0037650 | Length: | 274 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_504963.1 | Gene: | scl-26 / 183662 | WormBaseID: | WBGene00016821 | Length: | 208 | Species: | Caenorhabditis elegans |
Alignment Length: | 196 | Identity: | 34/196 - (17%) |
---|---|---|---|
Similarity: | 71/196 - (36%) | Gaps: | 62/196 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 97 WGLGNLPRAVKFKNIKWDDELSVMAMRVSNQCLQHTFSPCVNTFLYKDVGESSDFVKVQNTSKGF 161
Fly 162 NVISF-LNMWFEYHKMMKPSYVN-------NFPNIAPQDRLIIFANLIYEKNKKMGCGMVKS--- 215
Fly 216 --GQG-----RFLTCLFDKKIKP-NQKLYTTRLNDPFRTNRKTNETESIQSN----SSSTEAIVN 268
Fly 269 L 269 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11977 | NP_649855.3 | SCP_euk | 81..226 | CDD:240180 | 24/146 (16%) |
scl-26 | NP_504963.1 | CAP_euk | 30..168 | CDD:349399 | 24/146 (16%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1528782at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |