DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11977 and C07A4.3

DIOPT Version :9

Sequence 1:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_509707.2 Gene:C07A4.3 / 182352 WormBaseID:WBGene00007398 Length:207 Species:Caenorhabditis elegans


Alignment Length:242 Identity:45/242 - (18%)
Similarity:73/242 - (30%) Gaps:84/242 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 YVQKKHYNIPVKPPDYCNADICPANKKHITCGFKFWSTKCGRNHEGVRMSDYRYDIVRNVNNFRR 93
            |:|.|.....:.|.:|...|:            |.|                   ||...|.:|.
 Worm    24 YMQNKSLEDKLDPAEYSIKDL------------KKW-------------------IVHFHNKYRA 57

  Fly    94 -------KLEWGLGNLPRAVKFKNIKWDDELSVMAMRVSNQCLQHTFSPCVNTFLYKDVGESSDF 151
                   .::..|.||.:       ||.||     |....:||.|.                   
 Worm    58 HHSSPAVTVDSNLTNLAQ-------KWSDE-----MAFHKKCLVHE------------------- 91

  Fly   152 VKVQNTSKGFNVISFLNMWFE---------YHKMMKPSYVNNFPNIAP--QDRLIIFANLIYEKN 205
               |.:..|.|:.||.:..|.         .|......|..|:....|  ..::..|..|:::.:
 Worm    92 ---QPSKYGENLTSFASSKFPSPKTCAAALIHGFYTEGYGFNYTRFNPGSWSKVGHFTQLLWKNS 153

  Fly   206 KKMGCGMVKSGQGRFLTCLFDKKIKPNQKLYTTR-LNDPFRTNRKTN 251
            :|:|.|:..:.:|.........|..|...:.|:. ..|..|..:.|:
 Worm   154 RKIGVGVSVAKRGTMYHVYVCIKYDPPGNMQTSEAYMDNVRAPKSTS 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11977NP_649855.3 SCP_euk 81..226 CDD:240180 31/162 (19%)
C07A4.3NP_509707.2 CAP_GAPR1-like 43..183 CDD:349401 36/204 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.