DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11977 and GLIPR2

DIOPT Version :9

Sequence 1:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001273942.1 Gene:GLIPR2 / 152007 HGNCID:18007 Length:169 Species:Homo sapiens


Alignment Length:177 Identity:30/177 - (16%)
Similarity:64/177 - (36%) Gaps:53/177 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 YRYDIVRNVNNFRRKLEWGLGNLPRAVKFKNIKWDDELSVMAMRVSNQCLQHTFSP------CVN 138
            :..::::..|.:|:|     ..:|.....||:..:.:....|: .|.:.|:|  ||      |  
Human    24 FHNEVLKAHNEYRQK-----HGVPPLKLCKNLNREAQQYSEAL-ASTRILKH--SPESSRGQC-- 78

  Fly   139 TFLYKDVGESSDFVKVQNTSKGFNVISFLNMWF---EYHKMMKPSYVNNFPNIAPQDRLIIFANL 200
                   ||:..:.....|.|     ...:.|:   :.:...:|.:.:...:         |..:
Human    79 -------GENLAWASYDQTGK-----EVADRWYSEIKNYNFQQPGFTSGTGH---------FTAM 122

  Fly   201 IYEKNKKMGCGMVKSGQG------RFLTC-------LFDKKIKPNQK 234
            :::..||||.|...:..|      |:...       .|::.:.|.:|
Human   123 VWKNTKKMGVGKASASDGSSFVVARYFPAGNVVNEGFFEENVLPPKK 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11977NP_649855.3 SCP_euk 81..226 CDD:240180 27/166 (16%)
GLIPR2NP_001273942.1 SCP_GAPR-1_like 23..154 CDD:240182 27/160 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.