DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11977 and GLIPR1

DIOPT Version :10

Sequence 1:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_006842.2 Gene:GLIPR1 / 11010 HGNCID:17001 Length:266 Species:Homo sapiens


Alignment Length:111 Identity:27/111 - (24%)
Similarity:43/111 - (38%) Gaps:32/111 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 VRMSDYRYDIVRNVNNFRRKLEWGLGNLPRAVKFKNIKWDDELSVMAMRVSNQCLQHTFSPCVNT 139
            :...|:..|.||..|.||.:::      |.|.....:.||..|:.:|...::.|   .||.  ||
Human    28 IENEDFIKDCVRIHNKFRSEVK------PTASDMLYMTWDPALAQIAKAWASNC---QFSH--NT 81

  Fly   140 FL---------YKDVGESSDFVKVQNTSKG----FNVISFLNMWFE 172
            .|         :..:||        |...|    |:|.|.:..|::
Human    82 RLKPPHKLHPNFTSLGE--------NIWTGSVPIFSVSSAITNWYD 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11977NP_649855.3 CAP_euk 81..226 CDD:349399 26/105 (25%)
GLIPR1NP_006842.2 CAP_GLIPR1-like 32..179 CDD:349404 27/107 (25%)

Return to query results.
Submit another query.