DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11977 and pi15

DIOPT Version :9

Sequence 1:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster
Sequence 2:XP_002937120.1 Gene:pi15 / 100489915 XenbaseID:XB-GENE-989406 Length:258 Species:Xenopus tropicalis


Alignment Length:142 Identity:27/142 - (19%)
Similarity:55/142 - (38%) Gaps:36/142 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 IVRNVNNFRRKLEWGLGNLPRAVKFKNIKWDDELSVMAMRVSNQCL-QHTFSPCVNTFLYKDVGE 147
            ||...|..|.|:      .|.|...:.:.||:.|:.:|...:..|: .|  .|   ::|.|.:|:
 Frog    70 IVEYHNQVRGKV------FPPAANMEYMVWDENLAKLAEAWAATCIWDH--GP---SYLLKFLGQ 123

  Fly   148 SSDFVKVQNTSKGFNVISFLNMWFEYHKMMKPSYVNNFPNIAPQD------------RLIIFANL 200
            :...    .|.:..:::..:..|::..|    .|.  ||  .||:            ....:..:
 Frog   124 NLSV----RTGRYKSILQLVKPWYDEVK----DYA--FP--YPQECNPRCPLRCYGPMCTHYTQM 176

  Fly   201 IYEKNKKMGCGM 212
            ::....::||.:
 Frog   177 VWATTNRIGCAI 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11977NP_649855.3 SCP_euk 81..226 CDD:240180 27/142 (19%)
pi15XP_002937120.1 CAP_PI15 67..212 CDD:349408 27/142 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.