DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11977 and crispld1a

DIOPT Version :9

Sequence 1:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster
Sequence 2:XP_001920421.2 Gene:crispld1a / 100149104 ZFINID:ZDB-GENE-090612-1 Length:508 Species:Danio rerio


Alignment Length:180 Identity:40/180 - (22%)
Similarity:61/180 - (33%) Gaps:49/180 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 CNADICPAN------KKHITCGFKFWSTKCGRN-HEGVRMSDYRY-DIVRN------VNNFRRKL 95
            ||...|||.      |...|..:...|:.|... |.||..:|..: |:.|.      :.:::..|
Zfish   315 CNRYECPAGCLDSMVKVVGTVYYDMQSSICRAGIHYGVIDNDGGWVDVTRQGRKDFFIKSYKNGL 379

  Fly    96 EWGLGNLPRA-------VKFKNIKWDDELSVMA-----------MRVSNQCLQHT--FSPCVNTF 140
            : ..|....|       |..|.|..|..:||:.           :.....||:..  .|..:.|.
Zfish   380 Q-SHGKYQSANAFTVSKVTVKVITCDTTVSVLCPYQKPARHCPRIYCPRNCLEENSQLSRVIGTR 443

  Fly   141 LYKDVGESSDFVK-------VQNTSKGFNVISFLNMWFEYHKMMKPSYVN 183
            :|.|   .|...:       |.|.|.|:..:    |..:..|:...||.|
Zfish   444 IYSD---KSSICRSAIHAGVVSNESGGYIDV----MPTDNRKLYTSSYQN 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11977NP_649855.3 SCP_euk 81..226 CDD:240180 27/137 (20%)
crispld1aXP_001920421.2 SCP_euk 68..212 CDD:240180
LCCL 298..381 CDD:128866 16/66 (24%)
LCCL 401..500 CDD:281766 20/93 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.