DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31100 and ARN2

DIOPT Version :9

Sequence 1:NP_001262395.1 Gene:CG31100 / 41075 FlyBaseID:FBgn0051100 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_011816.2 Gene:ARN2 / 856338 SGDID:S000001039 Length:620 Species:Saccharomyces cerevisiae


Alignment Length:335 Identity:63/335 - (18%)
Similarity:119/335 - (35%) Gaps:98/335 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 VSIKNILLFGYGMTLGF-PTIVIPAIQGGEGRSETSGDILLNKDEISWFSSINLICVPLGCLFSG 117
            :.|...:.|.|.|..|: .||::.|:.    .|.:|...::|     .:|.:..:..|    |.|
Yeast   359 LGIMFFICFVYQMAAGYLYTILVVAVD----ESASSATRIIN-----LYSFVTAVVAP----FLG 410

  Fly   118 LLTQPLGKRRAMQFV----NLPILAAWLMFHFATRTE---HLYAALCLAGLGGGLMEAPVLTYVA 175
            |:.  ....|...::    :|..:...|.:.:.:..:   .:.|.:.:.||...|.:.|.:..:.
Yeast   411 LIV--TRSSRLKSYIIFGGSLYFITMGLFYRYRSGQDADGGIIAGMVIWGLSSCLFDYPTIVSIQ 473

  Fly   176 EITEPKYRGILSALGTT---------CVITG-VFIQFILGSLMDWRSVAAVSSAFPVITIIMLCF 230
            .:|..:....::||..|         ..|:| ::.|.:...|:.:...|.:::|           
Yeast   474 SVTSHENMATVTALNYTVFRIGGAVAAAISGAIWTQSLYPKLLHYMGDADLATA----------- 527

  Fly   231 VPESPVWLIREQRFREAVKSLQWLRGWVPEHMIEA-EFNQLYDELITQKAIELSADGIPPPGQRR 294
            ...||:..|....:...|:|.          |:|| ...|.|:.::   |:..||          
Yeast   528 AYGSPLTFILSNPWGTPVRSA----------MVEAYRHVQKYEVIV---ALVFSA---------- 569

  Fly   295 TLGQRLRMWRKRSFLVPFLLVSFSF----FTGHFSGKTPLQTYAVQIFHTLKAPMNKYHATILLG 355
                            |..|::|..    .|..|:.|.|.:.| ||...  ..|:|.:       
Yeast   570 ----------------PMFLLTFCVRDPRLTEDFAQKLPDREY-VQTKE--DDPINDW------- 608

  Fly   356 VAEMLATILG 365
            :|:..|..||
Yeast   609 IAKRFAKALG 618

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31100NP_001262395.1 MFS 59..>232 CDD:119392 33/190 (17%)
Sugar_tr 98..633 CDD:278511 52/290 (18%)
MFS <531..616 CDD:119392
ARN2NP_011816.2 MFS_ARN_like 69..581 CDD:340880 50/286 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.