DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31100 and MAL11

DIOPT Version :9

Sequence 1:NP_001262395.1 Gene:CG31100 / 41075 FlyBaseID:FBgn0051100 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_011805.3 Gene:MAL11 / 853207 SGDID:S000003521 Length:616 Species:Saccharomyces cerevisiae


Alignment Length:338 Identity:76/338 - (22%)
Similarity:134/338 - (39%) Gaps:74/338 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 ATSDVEVSN-------FRRALPQFLAVSIKNIL------LFGYGMTLGFPTIVIPAIQ------G 80
            ||.|...:|       .::||.::...::.:||      :.||...|......:|..|      .
Yeast    80 ATDDANEANSEEKSMTLKQALLKYPKAALWSILVSTTLVMEGYDTALLSALYALPVFQRKFGTLN 144

  Fly    81 GEGRSETSGDILLNKDEISWFSSINLICV----PLGCLFSGLLTQPLGKRRAMQFVNLPILAAWL 141
            |||..|.:.         .|...:|: ||    .:|...:..:.:.:|.|..| ...|.:|.|::
Yeast   145 GEGSYEITS---------QWQIGLNM-CVLCGEMIGLQITTYMVEFMGNRYTM-ITALGLLTAYI 198

  Fly   142 -MFHFATRTEHLYAALCLAGLGGGLMEAPVLTYVAEITEPKYRGILSALGTTCVITG-VFIQFIL 204
             :.::......:.....|:.:..|..::..:||.:|:.....|..:::....|.:.| :|...|:
Yeast   199 FILYYCKSLAMIAVGQILSAIPWGCFQSLAVTYASEVCPLALRYYMTSYSNICWLFGQIFASGIM 263

  Fly   205 --------GSLMDWRSVAAVSSAFPVITIIMLCFVPESPVWLIREQRFREAVKSL-QWLRGWVPE 260
                    .|.:.::...|:...:|...:|.:.|.||||.||:|:.|..||.||| :.|.|...|
Yeast   264 KNSQENLGNSDLGYKLPFALQWIWPAPLMIGIFFAPESPWWLVRKDRVAEARKSLSRILSGKGAE 328

  Fly   261 HMIEAEFNQLYDELITQKAIELSADGIPPPGQRRTLGQRLRMWRKRSFLVPFLLVSFSFFTGHFS 325
            ..|:.:        :|.|.|||:.:           .:||...:..||        |:.|.|...
Yeast   329 KDIQVD--------LTLKQIELTIE-----------KERLLASKSGSF--------FNCFKGVNG 366

  Fly   326 GKTPLQ--TYAVQ 336
            .:|.|.  |:..|
Yeast   367 RRTRLACLTWVAQ 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31100NP_001262395.1 MFS 59..>232 CDD:119392 37/198 (19%)
Sugar_tr 98..633 CDD:278511 59/256 (23%)
MFS <531..616 CDD:119392
MAL11NP_011805.3 SP 81..563 CDD:273317 75/337 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.