DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31100 and CG17930

DIOPT Version :9

Sequence 1:NP_001262395.1 Gene:CG31100 / 41075 FlyBaseID:FBgn0051100 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_650533.1 Gene:CG17930 / 41979 FlyBaseID:FBgn0038416 Length:502 Species:Drosophila melanogaster


Alignment Length:400 Identity:105/400 - (26%)
Similarity:158/400 - (39%) Gaps:101/400 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 SNFRRALPQFLAVSIKNILLFGY-GMTLGFPTIVIPAIQG-GEGRSETSGDILLNKDEISWFSSI 104
            ||.|.|.|..........|||.| ||.:.         || |...:..|.:.|  :.:.|||   
  Fly    52 SNSRWATPTQTQSGTAATLLFVYAGMDMA---------QGLGWNLTAVSANTL--EFQYSWF--- 102

  Fly   105 NLICVPLGCLFSGLLTQPLGK------------RRAMQFVNLPILAAWLMFHFATRTEHLYAALC 157
              |.|.:|.:.|.:.:..|.|            ..|:.||:.|.           ..|.:.||..
  Fly   103 --IGVIIGAVVSAITSAFLPKIVFYGLGGVMNLIDAIIFVSAPY-----------EYESILAARY 154

  Fly   158 LAGLGGGLMEAPVLTYVAEITEPKYRGILSALGTTCVITGVFIQFILGSLMDW-----RSVAAVS 217
            :.|:|.||:..|.|.:.|||.....||...||....:..||.||.|..|  .|     .::..|.
  Fly   155 VGGVGIGLITVPFLIHSAEIASSTNRGTCCALEQYGLALGVAIQVIYDS--QWSQGLGMTINRVH 217

  Fly   218 SAFPVI-TIIMLCFVP---ESPVWLIR---EQRFREAVKSLQ---WLRGWVPEHMIEAEFNQLYD 272
            ..|.:: |.|.|..|.   :||::.||   ||:.|.:||.|.   |.|        ||. ::.||
  Fly   218 GIFGIVFTAIALGSVAITIDSPIFYIRQNQEQKARASVKQLMGSYWTR--------EAG-DRAYD 273

  Fly   273 ELITQKAIELSADGIPPPGQRRTLGQRLRMWRKRSFLVPFL-LVSFSFFTGHFSGKTPLQTYAVQ 336
            | .....:|.||.|:   |::  ||:.         ::||| |:.|..|.. |:...||   :..
  Fly   274 E-AKLYVVEGSAQGV---GEQ--LGES---------MMPFLKLLLFRCFVA-FTFSVPL---SYS 319

  Fly   337 IFHTLKAPMNKYHA--TILLGVAEMLATILGVVLIHFTGKRPLVLVSTVGTGLCFFGT------- 392
            |..|.:......|:  ||:.|:..::..::...::...|::   .||.:|. :|..|.       
  Fly   320 ILTTTELVEGTLHSWPTIIFGLLRLIGALITFAVLDTVGRK---FVSLLGL-MCMAGLMLGMAGV 380

  Fly   393 -ATYAHFLSE 401
             ..|.|...:
  Fly   381 YGDYGHIFDD 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31100NP_001262395.1 MFS 59..>232 CDD:119392 52/192 (27%)
Sugar_tr 98..633 CDD:278511 89/341 (26%)
MFS <531..616 CDD:119392
CG17930NP_650533.1 Sugar_tr 102..493 CDD:278511 87/338 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.