DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31100 and CG14160

DIOPT Version :9

Sequence 1:NP_001262395.1 Gene:CG31100 / 41075 FlyBaseID:FBgn0051100 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_648380.2 Gene:CG14160 / 39177 FlyBaseID:FBgn0036066 Length:483 Species:Drosophila melanogaster


Alignment Length:422 Identity:85/422 - (20%)
Similarity:157/422 - (37%) Gaps:99/422 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 QFLAVSIKNILLFGYGMTLGFPTIVIPAIQGGEGRSETSGDILLNKDE----ISWFSSINLICVP 110
            ||.:::..:|:..|.||.|.:.....||           |..|.|.:.    :|||     |...
  Fly    25 QFQSMASASIVFVGCGMRLAWSIFDTPA-----------GKFLNNHNTHNLMMSWF-----IGAA 73

  Fly   111 LGCLFSGLLTQPLGKRRAMQFVNLPILAAWLMFHFATRTEHLYAALCLA----GLGGGLMEAPVL 171
            :|.|.:.|..|.:.|..|.......::.|.::  .....:|..|| |.:    |...||.:...|
  Fly    74 VGALLAALFVQRVTKNVAYTSSGFLMIIAGIL--NVVLPQHFLAA-CYSSVSVGAAYGLTQIQAL 135

  Fly   172 TYVAEITEPKYRGILSALGTTCVITGVFIQF-----------------------ILGSLMDWRSV 213
            ...:|:.....||:|.:.....:..||.:|.                       :.|.::....:
  Fly   136 VTGSEVAHKSIRGMLLSCEKIFLWLGVCMQVFYTRVWHNLRPLDTQGYEMHIDQLHGMVLAGLGL 200

  Fly   214 AAVSSAFPVITIIMLCFVPESPVWLIREQRFREAVKSLQWLRGWVPEHMI--EAEFNQLYDELIT 276
            .||        |:.|....|||:.|:.::|.....::|:.|.|.....::  ..:..||:.....
  Fly   201 GAV--------ILALAHRLESPLLLLHQERDMAVGETLKALHGQSTTELVRLREDCRQLHSARDW 257

  Fly   277 QKAIELSADGIPPPGQRRTLGQRLRMWRKRSFLVPF-----------LLVSFSFFTGHFSGKTPL 330
            ::.:|...:.:..          .|:|.:|  ::||           |.||.|:          .
  Fly   258 ERFVEEPEESVAD----------WRVWARR--ILPFFKVLLLRCFATLAVSLSY----------N 300

  Fly   331 QTYAVQIFHTLKAPMNKYHATILLGVAEMLATILGVVLIHFTGKRPLVLVS--TVGTGLCFFGTA 393
            :.:.|..:|.|:..||   ....|..|.::.::||..::.:.|:|.:..:|  ..|..:...| .
  Fly   301 RAFVVVSWHGLECDMN---CMYWLAFAGLIGSVLGAFVVDWQGRRKVCSLSLFLAGVVIVMVG-G 361

  Fly   394 TYAHFLSEVPGFTVNNVVVNASSIMPKEGILS 425
            .:.|..|....|...|::|.|..::..|.|::
  Fly   362 VFDHLESVKRSFYDINLLVIALLMLLFEVIVA 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31100NP_001262395.1 MFS 59..>232 CDD:119392 41/203 (20%)
Sugar_tr 98..633 CDD:278511 73/370 (20%)
MFS <531..616 CDD:119392
CG14160NP_648380.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.