DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31100 and LOC101882789

DIOPT Version :9

Sequence 1:NP_001262395.1 Gene:CG31100 / 41075 FlyBaseID:FBgn0051100 Length:716 Species:Drosophila melanogaster
Sequence 2:XP_021331508.1 Gene:LOC101882789 / 101882789 -ID:- Length:181 Species:Danio rerio


Alignment Length:123 Identity:32/123 - (26%)
Similarity:52/123 - (42%) Gaps:17/123 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 CLAGLGGGLMEAPVLTYVAEITEPKYRGILSALGTTCVITGVFIQFILGSLMD------WRSVAA 215
            |...:..|:....|..|:||.:.|..||.|..:.|..:..|.|...::.....      ||.:..
Zfish    10 CWMSICAGIASMTVPVYIAETSPPHLRGRLVTINTLFITAGQFTASVIDGAFSYMKHEGWRYMLG 74

  Fly   216 VSSAFPVITIIMLCFVPESPVWLIREQRFREAVKSLQWLRGWVPEHMIEAEFNQLYDE 273
            :|....::..:...|:||||.|||::...::|.:.|..:||           ||..||
Zfish    75 LSVIPALLQFLGFLFLPESPRWLIQKGLTQKARRVLSQIRG-----------NQNIDE 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31100NP_001262395.1 MFS 59..>232 CDD:119392 17/80 (21%)
Sugar_tr 98..633 CDD:278511 32/123 (26%)
MFS <531..616 CDD:119392
LOC101882789XP_021331508.1 Sugar_tr <14..>135 CDD:331684 31/119 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D524131at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.