DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11975 and ATG18

DIOPT Version :9

Sequence 1:NP_001262394.1 Gene:CG11975 / 41074 FlyBaseID:FBgn0037648 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_444297.1 Gene:ATG18 / 850577 SGDID:S000001917 Length:500 Species:Saccharomyces cerevisiae


Alignment Length:353 Identity:96/353 - (27%)
Similarity:155/353 - (43%) Gaps:94/353 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LTEQNPYGNGLLYAAFNQDQGCFACATDTGFRVYNCDPLKEKERQYFPE--GGLSHVEMLFRCNY 65
            :::.:|..|   :..|||...|.:..|..||:::||:|.    .:::.|  ||.:.|||||..:.
Yeast     1 MSDSSPTIN---FINFNQTGTCISLGTSKGFKIFNCEPF----GKFYSEDSGGYAIVEMLFSTSL 58

  Fly    66 LALVGGGIRPLYPPNKVIVWDDLKKSPAISLDFNQPVRAVRLRRDRIVVVLEGVIKVFTFTQQPQ 130
            |||||.|.:|...|.::.:.:..|.|....:.|...:.:|::.:.|:||:|:..|.::..... :
Yeast    59 LALVGIGDQPALSPRRLRIINTKKHSIICEVTFPTSILSVKMNKSRLVVLLQEQIYIYDINTM-R 122

  Fly   131 QLHVFETSSNPNGLCVLCPHSNKSLLAFP-----------------------GRRT--------- 163
            .||..||:.||.||..:.|....|.|.:|                       |..|         
Yeast   123 LLHTIETNPNPRGLMAMSPSVANSYLVYPSPPKVINSEIKAHATTNNITLSVGGNTETSFKRDQQ 187

  Fly   164 --GHVQIVDL----ANTER-----------------------------APLEVI-AHEAGISCIA 192
              ||..|.||    :.|:|                             .|..|| ||:..|:.:|
Yeast   188 DAGHSDISDLDQYSSFTKRDDADPTSSNGGNSSIIKNGDVIVFNLETLQPTMVIEAHKGEIAAMA 252

  Fly   193 LNLQGTRLATAGEKGTLIRIFDTESGKKVSELRRGSNHANIFCINFNHQSTMVVVASDHGTIHVF 257
            ::..||.:|||.:|||:||:||.|:|.|:.:.|||:....|:.|:|:..|..:.|.....|:|:|
Yeast   253 ISFDGTLMATASDKGTIIRVFDIETGDKIYQFRRGTYATRIYSISFSEDSQYLAVTGSSKTVHIF 317

  Fly   258 ----------------NLEDNKPRESSL 269
                            |:|:....:|||
Yeast   318 KLGHSMSNNKLDSDDSNMEEAAADDSSL 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11975NP_001262394.1 WD40 repeat 102..136 CDD:293791 8/33 (24%)
WD40 141..>265 CDD:421866 51/207 (25%)
WD40 repeat 145..180 CDD:293791 14/101 (14%)
WD40 repeat 188..225 CDD:293791 17/36 (47%)
WD40 repeat 233..273 CDD:293791 13/53 (25%)
ATG18NP_444297.1 WD40 <224..318 CDD:421866 32/93 (34%)
WD40 repeat 249..285 CDD:293791 16/35 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54442
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R106
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.910

Return to query results.
Submit another query.