DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11975 and mug179

DIOPT Version :9

Sequence 1:NP_001262394.1 Gene:CG11975 / 41074 FlyBaseID:FBgn0037648 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_593843.1 Gene:mug179 / 2543297 PomBaseID:SPAC823.16c Length:335 Species:Schizosaccharomyces pombe


Alignment Length:350 Identity:97/350 - (27%)
Similarity:161/350 - (46%) Gaps:65/350 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLYAAFNQDQGCFACATDTGFRVYNCDPLK---EKERQYFPEGGLSHVEMLFRCNYLALVGGGIR 74
            :||.::|||:|..:..::.|::||..:|..   .|:     ..|.|..|||:..:.||.|  .|.
pombe     5 ILYCSWNQDRGFLSIGSENGYQVYRSNPFTLCFSKK-----ANGASICEMLYESSLLAFV--NIS 62

  Fly    75 PLYPPNKVIVWDDLKKSPAI-SLDFNQPVRAVRLRRDRIVVVLEGVIKVFTFTQQPQQLHVFETS 138
            |  ...:::...|:|:...: .:.:..||.:||...:|:||:::|.|.|:..    :.:.:..|.
pombe    63 P--ESTRLLKLVDIKRDIVLCRIFYPSPVLSVRFTWNRLVVLIKGSIYVYNL----KNMELINTL 121

  Fly   139 SNPNG-LCVLCPHSNKSLLAF-----PGRRTGHVQIVDLANTERA-PLEVI-AHEAGISCIALNL 195
            :...| :.....|.|  .:|:     ||.       :.||:.:.| |:.:| .|.:.:..:..:.
pombe   122 NTSKGNVIAFAVHEN--YVAYNSPTNPGD-------IYLASLDTAIPVTLIHCHSSAVQVVDFHP 177

  Fly   196 QGTRLATAGEKGTLIRIFDTESGKKVSELRRGSNHANIFCINFNHQSTMVVVASDHGTIHVFNLE 260
            :|..:|||..|||:||:..|..|:.|:|||||...|:|..|:|:.....:..||::||||||.:.
pombe   178 RGHLIATASAKGTVIRVITTSDGELVTELRRGYIPASIVSISFHPVEPFLACASENGTIHVFKIS 242

  Fly   261 DNKPRESSLPIIPKYFSSQWS----------------FVKFSIPQGPRCVCAF-------GADPN 302
            ......:|.|......||.||                |....||:     .:|       .:.|:
pombe   243 KQPSDPNSSPTSSVTVSSSWSKYLTSNVAKVWDTRKEFATAKIPE-----ASFYGKIIFSSSGPH 302

  Fly   303 SVVAICADGHYYKFLFN--NKGECS 325
            ..|| ...||||:|..|  |.|.|:
pombe   303 IQVA-SYSGHYYRFAVNLKNGGNCA 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11975NP_001262394.1 WD40 repeat 102..136 CDD:293791 9/33 (27%)
WD40 141..>265 CDD:421866 41/131 (31%)
WD40 repeat 145..180 CDD:293791 9/40 (23%)
WD40 repeat 188..225 CDD:293791 13/36 (36%)
WD40 repeat 233..273 CDD:293791 13/39 (33%)
mug179NP_593843.1 WD40 repeat 8..43 CDD:293791 9/39 (23%)
WD40 repeat 47..86 CDD:293791 10/42 (24%)
WD40 <64..>315 CDD:225201 71/269 (26%)
WD40 <87..240 CDD:295369 51/165 (31%)
WD40 repeat 89..123 CDD:293791 10/37 (27%)
WD40 repeat 127..165 CDD:293791 10/46 (22%)
WD40 repeat 170..208 CDD:293791 14/37 (38%)
WD40 repeat 216..246 CDD:293791 10/29 (34%)
WD40 repeat 253..284 CDD:293791 5/30 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54442
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.880

Return to query results.
Submit another query.