DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(var)3-9 and ZBTB25

DIOPT Version :9

Sequence 1:NP_649852.2 Gene:E(var)3-9 / 41073 FlyBaseID:FBgn0260243 Length:588 Species:Drosophila melanogaster
Sequence 2:XP_016877119.1 Gene:ZBTB25 / 7597 HGNCID:13112 Length:560 Species:Homo sapiens


Alignment Length:372 Identity:81/372 - (21%)
Similarity:127/372 - (34%) Gaps:117/372 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 GFICSSKETL-----KEHKQA------------VHVRTKC-------------------TYCGKT 343
            ||:|.....:     |.|:..            :|..::|                   .|.||.
Human   146 GFLCDCTVAIGDVYFKAHRAVLAAFSNYFKMIFIHQTSECIKIQPTDIQPDIFSYLLHIMYTGKG 210

  Fly   344 VKNATLHAHLKKHLEEGEAE-LAQQLKKLEQL--PVNLQSQHLSSLESSVAEVTTASEGSNIPGE 405
            .|....|:.|::.:....|: |:....::.|:  |..:||.:|..::.|..:.|...:|..:...
Human   211 PKQIVDHSRLEEGIRFLHADYLSHIATEMNQVFSPETVQSSNLYGIQISTTQKTVVKQGLEVKEA 275

  Fly   406 STVPEDSNVTENSSVPSIETS-------NHADIQ--CP--------MGPPAN--GEVPDVADV-- 449
            .:....:........|.::.|       ..||.|  ||        ..||.:  .|..|...|  
Human   276 PSSNSGNRAAVQGDHPQLQLSLAIGLDDGTADQQRACPATQALEEHQKPPVSIKQERCDPESVIS 340

  Fly   450 ---ASPSTEP-----TESVTK---CSYCSDTFEKAQQLQAHVLATHTQTRKRRRSSDNQSLVRKT 503
               .|||:|.     ||:..|   |.||.:.|:....|:.| |.||                  .
Human   341 QSHPSPSSEVTGPTFTENSVKIHLCHYCGERFDSRSNLRQH-LHTH------------------V 386

  Fly   504 TQEIPTSPIAKITKKQTI-------ESKER---------VVLESSSQLDSTAQ------QESRTS 546
            :..:|....|.|.:...:       |:.|.         :|.|:..|.|.|.:      |.|:.|
Human   387 SGSLPFGVPASILESNDLGEVHPLNENSEALECRRLSSFIVKENEQQPDHTNRGTTEPLQISQVS 451

  Fly   547 ATSNDSSPVQ-----QVPEKAYISCYICGRSFDLKIKLNRHLKQHKG 588
            ..|.|:.||:     ....|..:||.|||..|..|.:|..|:..|||
Human   452 LISKDTEPVELNCNFSFSRKRKMSCTICGHKFPRKSQLLEHMYTHKG 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(var)3-9NP_649852.2 zf-AD 18..102 CDD:285071
zf-C2H2_2 253..>334 CDD:289522 6/35 (17%)
C2H2 Zn finger 253..274 CDD:275368
C2H2 Zn finger 281..303 CDD:275368
PHA00732 310..>358 CDD:177300 13/78 (17%)
C2H2 Zn finger 311..332 CDD:275368 5/33 (15%)
C2H2 Zn finger 337..356 CDD:275368 7/37 (19%)
ZBTB25XP_016877119.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.