Sequence 1: | NP_649852.2 | Gene: | E(var)3-9 / 41073 | FlyBaseID: | FBgn0260243 | Length: | 588 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001258769.1 | Gene: | IKZF5 / 64376 | HGNCID: | 14283 | Length: | 419 | Species: | Homo sapiens |
Alignment Length: | 384 | Identity: | 70/384 - (18%) |
---|---|---|---|
Similarity: | 133/384 - (34%) | Gaps: | 105/384 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 176 PEPKNFASPVDSRFDMIDNDALTSGMLGPSI------EDLSGTVDDGTEDEEEEEEEIVRFTYDD 234
Fly 235 DNDAAAPLPPPLYSPVVCCKLCFYESPDQDAHMEHMRRTHLLKDWECHICGKKFTNAQESRIKFH 299
Fly 300 IKYHKLQRHVKCPVCGFICSSKETLKEHKQAVHVRTKCTYCGKTVKNATLHAHLKKH---LEEGE 361
Fly 362 AELAQQLKKL--------------------EQLPVNLQSQHLSSL------------------ES 388
Fly 389 SVAEVTT-ASEGSNIPGE---------------------------------STVPEDSNVTENSS 419
Fly 420 VPSIETSNHADIQCPMG-PPANGEVPDVADVASPST-------EPTESVTKCSYCSDTF 470 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(var)3-9 | NP_649852.2 | zf-AD | 18..102 | CDD:285071 | |
zf-C2H2_2 | 253..>334 | CDD:289522 | 25/80 (31%) | ||
C2H2 Zn finger | 253..274 | CDD:275368 | 7/20 (35%) | ||
C2H2 Zn finger | 281..303 | CDD:275368 | 7/21 (33%) | ||
PHA00732 | 310..>358 | CDD:177300 | 12/50 (24%) | ||
C2H2 Zn finger | 311..332 | CDD:275368 | 7/20 (35%) | ||
C2H2 Zn finger | 337..356 | CDD:275368 | 2/18 (11%) | ||
IKZF5 | NP_001258769.1 | C2H2 Zn finger | 84..104 | CDD:275368 | 7/19 (37%) |
zf-H2C2_2 | 96..121 | CDD:404364 | 8/26 (31%) | ||
C2H2 Zn finger | 112..132 | CDD:275368 | 7/21 (33%) | ||
zf-H2C2_2 | 124..148 | CDD:404364 | 6/23 (26%) | ||
C2H2 Zn finger | 140..158 | CDD:275368 | 7/17 (41%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 223..247 | 2/23 (9%) | |||
PHA03269 | 251..>361 | CDD:165527 | 18/110 (16%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 262..356 | 16/94 (17%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |