DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(var)3-9 and CG2678

DIOPT Version :9

Sequence 1:NP_649852.2 Gene:E(var)3-9 / 41073 FlyBaseID:FBgn0260243 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_649750.1 Gene:CG2678 / 40937 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster


Alignment Length:543 Identity:101/543 - (18%)
Similarity:171/543 - (31%) Gaps:185/543 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CRTCGIYFTMGMDMDQAIVKPIFGSDDAAVAD-----MAEILEQMNDWNIKVAREDGRPQYMCIA 77
            ||||       ||....:| .||.:....|.|     ::.||.:..:..:|  |.|..||::|::
  Fly     9 CRTC-------MDETGTLV-DIFANVRDPVLDEPEMSLSHILARCTERPVK--RGDLLPQFICVS 63

  Fly    78 CIAEFHRLIKFKRSCVETQEQFGELEYQREHNGIVIKREIEPEEEKFCGFIYLDTDEEDN----- 137
            |:.......:||..        .|..||  |...|:.:...||.:........|.::..|     
  Fly    64 CVLAVQNAFRFKWQ--------SEQSYQ--HFFRVLNQSGAPENQVHLAACNGDKNQIINQKMQL 118

  Fly   138 -SDEDGSRRVCAVFDIPHVPIKEEHMARVPLQNSDKFQPPE-----PKNFASPVDSRFDMIDNDA 196
             ||.....:.......|...:.::...:..||..:...|||     |:......:.:.|||..:|
  Fly   119 KSDRQQDTQQMTKTQKPDDDLSQKQTLQAKLQEGNIDGPPESFTLHPRKRTCRTEEQADMIPKEA 183

  Fly   197 LTSGMLGPSIEDLSGTVDDGTEDEEEEEEEIVRFTYDDDNDAAAPLPPPLYSPVVCCKLCFYESP 261
            ..|                                                :.::|         
  Fly   184 TRS------------------------------------------------TKMIC--------- 191

  Fly   262 DQDAHMEHMRRTHLLKDWECHICGKKFTNAQESRIKFHIKYHKLQRHV-----KCPVCGFICSSK 321
            |.|.:            :.|..|.|:|.:..:           |:.|:     :||.|......|
  Fly   192 DADGY------------YNCPHCSKRFCSQTQ-----------LRTHITDLCNRCPYCPRTYMQK 233

  Fly   322 ETLKEH-----KQAVHVRTKCTYCGKT-VKNATLHAHLKKHLEEGEAELAQ-QLKKLEQLPVNLQ 379
            ..||.|     .:..|   ||.:|.|. ::...|..||:.|..:|....:| ....:|.:.:.:.
  Fly   234 SNLKRHLRNHLSKPAH---KCFHCSKAFMRKDHLKRHLRTHDSDGPLSCSQCSAVFIEHVQLEIH 295

  Fly   380 SQHLSSLESSVAEVTTASEGSNIPG----ESTVPEDSNVTENS-SVPSIETSNHADIQCPMGPPA 439
            .:                |....||    |||...||:.::.: .:....|.|..:..|.: ||.
  Fly   296 RR----------------EHKQRPGSSKSESTKDPDSDDSDQAQDLKPKWTKNTFNGTCSI-PPM 343

  Fly   440 NGEVPDVADVASPSTEPT-------------ESVTKCSYCSDTFEKAQQLQAH------------ 479
            ....| :.|:........             ..:.||:|||:.|:..:.|:.|            
  Fly   344 LKPKP-ICDICQKKFSSVYALKRHMLTHNRQHHLKKCTYCSEEFKTEKHLKRHERGHMGDLFRCE 407

  Fly   480 ------VLATHTQTRKRRRSSDN 496
                  |...:.:..|:|..|:|
  Fly   408 FCSLVFVDVNYLRKHKKRIHSNN 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(var)3-9NP_649852.2 zf-AD 18..102 CDD:285071 22/88 (25%)
zf-C2H2_2 253..>334 CDD:289522 16/90 (18%)
C2H2 Zn finger 253..274 CDD:275368 2/20 (10%)
C2H2 Zn finger 281..303 CDD:275368 4/21 (19%)
PHA00732 310..>358 CDD:177300 16/53 (30%)
C2H2 Zn finger 311..332 CDD:275368 7/25 (28%)
C2H2 Zn finger 337..356 CDD:275368 6/19 (32%)
CG2678NP_649750.1 zf-AD 8..85 CDD:214871 25/95 (26%)
COG5048 220..>284 CDD:227381 18/66 (27%)
C2H2 Zn finger 223..243 CDD:275368 7/19 (37%)
zf-C2H2 249..271 CDD:278523 8/24 (33%)
C2H2 Zn finger 251..271 CDD:275368 6/19 (32%)
C2H2 Zn finger 279..299 CDD:275368 2/35 (6%)
C2H2 Zn finger 350..370 CDD:275368 1/19 (5%)
C2H2 Zn finger 379..399 CDD:275368 7/19 (37%)
C2H2 Zn finger 406..427 CDD:275368 3/20 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8297
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.