DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RagA-B and rraga

DIOPT Version :9

Sequence 1:NP_649850.1 Gene:RagA-B / 41071 FlyBaseID:FBgn0037647 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001006897.1 Gene:rraga / 448744 XenbaseID:XB-GENE-5756345 Length:313 Species:Xenopus tropicalis


Alignment Length:306 Identity:240/306 - (78%)
Similarity:269/306 - (87%) Gaps:3/306 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKKKVLLMGKSGSGKTSMRSIIFANYIARDTTRLGATIDVEHSHVRFLGNLVLNLWDCGGQEGFM 65
            |||||||||||||||||||||||||||||||.|||||||||||||||||||||||||||||:.||
 Frog     6 MKKKVLLMGKSGSGKTSMRSIIFANYIARDTRRLGATIDVEHSHVRFLGNLVLNLWDCGGQDTFM 70

  Fly    66 KQYFAQQRDNIFRNVEVLIYVFDVESQEIERDIHYYQSCLEALLQNSPEAKIFCLVHKMDLVPEG 130
            :.||..||||||||||||||||||||:|:|:|:|||||||||:|||||:||:||||||||||.|.
 Frog    71 ENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSPDAKVFCLVHKMDLVQED 135

  Fly   131 LRESVFTERMEDLIKLSKPGNVTCFRTSIWDETLYKAWSSIVTMLIPNVAALENSVTHFGNVIEA 195
            .|:.:|.||.|||.:||:|.:..|||||||||||||||||||..|||||..||:::.:|..:|||
 Frog   136 QRDLIFKEREEDLRRLSRPLDCACFRTSIWDETLYKAWSSIVYQLIPNVQQLESNLRNFAQIIEA 200

  Fly   196 DEVLLFEKATFLVISHCQSKKNRDSHRFEKVSNIIKQFKLSCSKLGAKFQSMEVRNSAFAAFIDT 260
            |||||||:||||||||.|.|:.||.|||||:||||||||||||||.|.|||||||||.||||||.
 Frog   201 DEVLLFERATFLVISHYQCKEQRDIHRFEKISNIIKQFKLSCSKLAASFQSMEVRNSNFAAFIDI 265

  Fly   261 FTSNTYVMVVMSDPTLPSEATLVNIRNARKYFEELE---NPSNSAI 303
            ||||||||||||||::||.|||:|||||||:||:||   .|.:|.:
 Frog   266 FTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKLERVDGPKHSLL 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RagA-BNP_649850.1 Gem1 2..>146 CDD:224025 120/143 (84%)
RagA_like 4..287 CDD:206744 226/282 (80%)
rragaNP_001006897.1 RagA_like 9..292 CDD:206744 226/282 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 368 1.000 Domainoid score I914
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 484 1.000 Inparanoid score I1416
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D378768at33208
OrthoFinder 1 1.000 - - FOG0003768
OrthoInspector 1 1.000 - - oto103490
Panther 1 1.100 - - LDO PTHR11259
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R532
SonicParanoid 1 1.000 - - X2625
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.190

Return to query results.
Submit another query.