DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RagA-B and RagC-D

DIOPT Version :9

Sequence 1:NP_649850.1 Gene:RagA-B / 41071 FlyBaseID:FBgn0037647 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_610361.1 Gene:RagC-D / 35793 FlyBaseID:FBgn0033272 Length:385 Species:Drosophila melanogaster


Alignment Length:299 Identity:67/299 - (22%)
Similarity:130/299 - (43%) Gaps:38/299 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KKKVLLMGKSGSGKTSMRSIIFANYIARDTTRLGATIDVEHSHVRFLGNLVLNLWDCGGQEGFMK 66
            |.::||||...|||:|::.::|......:|..|.:|..:....:.....:...:||..||..|.:
  Fly    40 KPRILLMGMRRSGKSSIQKVVFHKMSPNETLFLESTSKIVKDDINNSSFVQFQIWDFPGQIDFFE 104

  Fly    67 QYFAQQRDNIFRNVEVLIYVFDVESQEIERDIHYYQSCLEALLQNSPEAKIFCLVHKMDLVPEGL 131
            ..|  ..|.||.....|::|.|.:....|....:..:.|:|...|. ..|....:||:|    |:
  Fly   105 PTF--DSDMIFGGCGALVFVIDAKDDYNEALTKFKNTVLQAYKVNK-RIKFEVFIHKVD----GI 162

  Fly   132 RESVFTERMEDLIK-----LSKPG----NVTCFRTSIWDETLYKAWSSIVTMLIPNVAALENSVT 187
            .:....|...|:.:     |::.|    :::...|||:|.::::|:|.:|..|||.:..|||.:.
  Fly   163 SDDSKMESQRDIHQRSSDDLNEAGLDQIHLSFHLTSIYDHSIFEAFSKVVQKLIPQLPTLENLLN 227

  Fly   188 HFGNVIEADEVLLFEKATFLVISHCQSKKNRDSHRFEKVSNIIKQFKLSCSKLGAKFQSMEVRNS 252
            .|......::..||:..:.:.|:       .||...:     ::.::|.|..:........:.:|
  Fly   228 IFIPNSGIEKAFLFDVVSKIYIA-------TDSSPVD-----MQTYELCCDMIDVVIDLSSIYSS 280

  Fly   253 AFAAFIDTFTSNTYVMVVMSDPTLPSEATLVNIRNARKY 291
            ...|| |:.:|:...:         :..|::.:|...|:
  Fly   281 EETAF-DSGSSSLIKL---------NNNTILYLREVNKF 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RagA-BNP_649850.1 Gem1 2..>146 CDD:224025 36/148 (24%)
RagA_like 4..287 CDD:206744 64/291 (22%)
RagC-DNP_610361.1 RagC_like 42..216 CDD:206745 44/180 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456389
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11259
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.