DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RagA-B and IL4

DIOPT Version :9

Sequence 1:NP_649850.1 Gene:RagA-B / 41071 FlyBaseID:FBgn0037647 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_000580.1 Gene:IL4 / 3565 HGNCID:6014 Length:153 Species:Homo sapiens


Alignment Length:41 Identity:17/41 - (41%)
Similarity:21/41 - (51%) Gaps:3/41 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 FANYIARDTTRLGATIDVEHSH---VRFLGNLVLNLWDCGG 60
            |.::..:||..||||....|.|   :|||..|..|||...|
Human    79 FYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAG 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RagA-BNP_649850.1 Gem1 2..>146 CDD:224025 17/41 (41%)
RagA_like 4..287 CDD:206744 17/41 (41%)
IL4NP_000580.1 IL4 28..149 CDD:307051 17/41 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3886
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.