DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RagA-B and Rraga

DIOPT Version :9

Sequence 1:NP_649850.1 Gene:RagA-B / 41071 FlyBaseID:FBgn0037647 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_446425.1 Gene:Rraga / 117044 RGDID:619804 Length:313 Species:Rattus norvegicus


Alignment Length:306 Identity:241/306 - (78%)
Similarity:267/306 - (87%) Gaps:3/306 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKKKVLLMGKSGSGKTSMRSIIFANYIARDTTRLGATIDVEHSHVRFLGNLVLNLWDCGGQEGFM 65
            |||||||||||||||||||||||||||||||.|||||||||||||||||||||||||||||:.||
  Rat     6 MKKKVLLMGKSGSGKTSMRSIIFANYIARDTRRLGATIDVEHSHVRFLGNLVLNLWDCGGQDTFM 70

  Fly    66 KQYFAQQRDNIFRNVEVLIYVFDVESQEIERDIHYYQSCLEALLQNSPEAKIFCLVHKMDLVPEG 130
            :.||..||||||||||||||||||||:|:|:|:|||||||||:|||||:|||||||||||||.|.
  Rat    71 ENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSPDAKIFCLVHKMDLVQED 135

  Fly   131 LRESVFTERMEDLIKLSKPGNVTCFRTSIWDETLYKAWSSIVTMLIPNVAALENSVTHFGNVIEA 195
            .|:.:|.||.|||.:||:|....|||||||||||||||||||..|||||..||.::.:|..:|||
  Rat   136 QRDLIFKEREEDLRRLSRPLECACFRTSIWDETLYKAWSSIVYQLIPNVQQLEMNLRNFAQIIEA 200

  Fly   196 DEVLLFEKATFLVISHCQSKKNRDSHRFEKVSNIIKQFKLSCSKLGAKFQSMEVRNSAFAAFIDT 260
            |||||||:||||||||.|.|:.||.|||||:||||||||||||||.|.|||||||||.||||||.
  Rat   201 DEVLLFERATFLVISHYQCKEQRDVHRFEKISNIIKQFKLSCSKLAASFQSMEVRNSNFAAFIDI 265

  Fly   261 FTSNTYVMVVMSDPTLPSEATLVNIRNARKYFEELE---NPSNSAI 303
            ||||||||||||||::||.|||:|||||||:||:||   .|.:|.:
  Rat   266 FTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKLERVDGPKHSLL 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RagA-BNP_649850.1 Gem1 2..>146 CDD:224025 121/143 (85%)
RagA_like 4..287 CDD:206744 227/282 (80%)
RragaNP_446425.1 RagA_like 9..292 CDD:206744 227/282 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345354
Domainoid 1 1.000 367 1.000 Domainoid score I892
eggNOG 1 0.900 - - E1_KOG3886
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 483 1.000 Inparanoid score I1397
OMA 1 1.010 - - QHG54125
OrthoDB 1 1.010 - - D378768at33208
OrthoFinder 1 1.000 - - FOG0003768
OrthoInspector 1 1.000 - - otm45294
orthoMCL 1 0.900 - - OOG6_102718
Panther 1 1.100 - - LDO PTHR11259
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2625
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.770

Return to query results.
Submit another query.