DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RagA-B and RragB

DIOPT Version :9

Sequence 1:NP_649850.1 Gene:RagA-B / 41071 FlyBaseID:FBgn0037647 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_446424.1 Gene:RragB / 117043 RGDID:619805 Length:374 Species:Rattus norvegicus


Alignment Length:324 Identity:240/324 - (74%)
Similarity:265/324 - (81%) Gaps:28/324 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKKKVLLMGKSGSGKTSMRSIIFANYIARDTTRLGATI--------------------------- 38
            |||||||||||||||||||||||||||||||.||||||                           
  Rat    39 MKKKVLLMGKSGSGKTSMRSIIFANYIARDTRRLGATILDRIHSLQINSSLSTYSLVDSVGNTKT 103

  Fly    39 -DVEHSHVRFLGNLVLNLWDCGGQEGFMKQYFAQQRDNIFRNVEVLIYVFDVESQEIERDIHYYQ 102
             |||||||||||||||||||||||:.||:.||..||||||||||||||||||||:|:|:|:||||
  Rat   104 FDVEHSHVRFLGNLVLNLWDCGGQDTFMENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQ 168

  Fly   103 SCLEALLQNSPEAKIFCLVHKMDLVPEGLRESVFTERMEDLIKLSKPGNVTCFRTSIWDETLYKA 167
            |||||:|||||||||||||||||||.|..|:.:|.||.|||.:||:|...:||||||||||||||
  Rat   169 SCLEAILQNSPEAKIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLECSCFRTSIWDETLYKA 233

  Fly   168 WSSIVTMLIPNVAALENSVTHFGNVIEADEVLLFEKATFLVISHCQSKKNRDSHRFEKVSNIIKQ 232
            |||||..|||||..||.::.:|..:||||||||||:||||||||.|.|:.||:|||||:||||||
  Rat   234 WSSIVYQLIPNVQQLEMNLRNFAEIIEADEVLLFERATFLVISHYQCKEQRDAHRFEKISNIIKQ 298

  Fly   233 FKLSCSKLGAKFQSMEVRNSAFAAFIDTFTSNTYVMVVMSDPTLPSEATLVNIRNARKYFEELE 296
            ||||||||.|.|||||||||.||||||.||||||||||||||::||.|||:|||||||:||:||
  Rat   299 FKLSCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKLE 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RagA-BNP_649850.1 Gem1 2..>146 CDD:224025 122/171 (71%)
RagA_like 4..287 CDD:206744 228/310 (74%)
RragBNP_446424.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
RagA_like 42..353 CDD:206744 228/310 (74%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345355
Domainoid 1 1.000 367 1.000 Domainoid score I892
eggNOG 1 0.900 - - E1_KOG3886
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 483 1.000 Inparanoid score I1397
OMA 1 1.010 - - QHG54125
OrthoDB 1 1.010 - - D378768at33208
OrthoFinder 1 1.000 - - FOG0003768
OrthoInspector 1 1.000 - - otm45294
orthoMCL 1 0.900 - - OOG6_102718
Panther 1 1.100 - - O PTHR11259
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2625
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.