DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAHbeta and NCE103

DIOPT Version :9

Sequence 1:NP_649849.1 Gene:CAHbeta / 41070 FlyBaseID:FBgn0037646 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_014362.3 Gene:NCE103 / 855692 SGDID:S000004981 Length:221 Species:Saccharomyces cerevisiae


Alignment Length:203 Identity:39/203 - (19%)
Similarity:72/203 - (35%) Gaps:56/203 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PKAVFFTCMDSRMIPTRYTDTHV----GDMFVVRNAGNLIPHAQHFQDEYFSCEPAALELGCVVN 92
            |..:|..|.||     ||.:..:    |::|..:|..|:.    |.:|....   |.||...:..
Yeast    50 PHTLFIGCSDS-----RYNENCLGVLPGEVFTWKNVANIC----HSEDLTLK---ATLEFAIICL 102

  Fly    93 DIRHIIVCGHSDCKAMNLLYQLRDPDFASKLNRRLSPLRSWLCTHANTSLERFQEWRDAGMKDPL 157
            .:..:|:|||:||..:.           :.|..:...|....|:|....|:...           
Yeast   103 KVNKVIICGHTDCGGIK-----------TCLTNQREALPKVNCSHLYKYLDDID----------- 145

  Fly   158 IFSSETPLRRFVAYIDEEQKF----ALEDK---LSQINTLQQMSNIASYGFLKARLESHDLHIHA 215
                       ..|.:|.|..    ...:|   ||..|..:|.:.|.....::..:::.:|.::.
Yeast   146 -----------TMYHEESQNLIHLKTQREKSHYLSHCNVKRQFNRIIENPTVQTAVQNGELQVYG 199

  Fly   216 LWFDIYTG 223
            |.:::..|
Yeast   200 LLYNVEDG 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAHbetaNP_649849.1 beta_CA_cladeB 7..228 CDD:238449 39/203 (19%)
NCE103NP_014362.3 beta_CA_cladeA 25..212 CDD:238448 39/203 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346427
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0288
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003269
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100995
Panther 1 1.100 - - LDO PTHR11002
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16263
SonicParanoid 1 1.000 - - X7634
TreeFam 1 0.960 - -
98.730

Return to query results.
Submit another query.